Lineage for d2qcva_ (2qcv A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137471Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2137472Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 2137707Family c.72.1.0: automated matches [191321] (1 protein)
    not a true family
  6. 2137708Protein automated matches [190117] (40 species)
    not a true protein
  7. 2137716Species Bacillus halodurans [TaxId:272558] [194493] (1 PDB entry)
  8. 2137717Domain d2qcva_: 2qcv A: [194494]
    automated match to d3pl2d_
    complexed with pge

Details for d2qcva_

PDB Entry: 2qcv (more details), 1.9 Å

PDB Description: crystal structure of a putative 5-dehydro-2-deoxygluconokinase (iolc) from bacillus halodurans c-125 at 1.90 a resolution
PDB Compounds: (A:) Putative 5-dehydro-2-deoxygluconokinase

SCOPe Domain Sequences for d2qcva_:

Sequence, based on SEQRES records: (download)

>d2qcva_ c.72.1.0 (A:) automated matches {Bacillus halodurans [TaxId: 272558]}
tyelstdrefdliaigracidlnaveynrpmeetmtfskyvggspanivigssklglkag
figkiaddqhgrfiesymrgvgvdtsnlvvdqeghktglafteikspeecsilmyrqdva
dlylspeevneayirrsklllvsgtalskspsreavlkairlakrndvkvvfeldyrpys
wetpeetavyyslvaeqsdivigtreefdvlenrtekgdndetirylfkhspelivikhg
vegsfaytkageayrgyayktkvlktfgagdsyasaflyalisgkgietalkygsasasi
vvskhsssdampsveeiealiekdetitia

Sequence, based on observed residues (ATOM records): (download)

>d2qcva_ c.72.1.0 (A:) automated matches {Bacillus halodurans [TaxId: 272558]}
tyelstdrefdliaigracidlnaveynrpmeetmtfskyvggspanivigssklglkag
figkiaddqhgrfiesymrgvgvdtsnlvvdqeghktglafteikspeecsilmyrqdva
dlylspeevneayirrsklllvsgtalskspsreavlkairlakrndvkvvfeldyrpys
wetpeetavyyslvaeqsdivigtreefdvlenrtekgdndetirylfkhspelivikhg
vegsfaytkageayrgyayktkvlktfgagdsyasaflyalisgkgietalkygsasasi
vvskampsveeiealiekdetitia

SCOPe Domain Coordinates for d2qcva_:

Click to download the PDB-style file with coordinates for d2qcva_.
(The format of our PDB-style files is described here.)

Timeline for d2qcva_: