Lineage for d1dgpb_ (1dgp B:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 360883Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 360884Superfamily a.128.1: Terpenoid synthases [48576] (5 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 360941Family a.128.1.4: Aristolochene/pentalenene synthase [48586] (2 proteins)
  6. 360942Protein Aristolochene synthase [48587] (1 species)
  7. 360943Species Fungus (Penicillium roqueforti) [TaxId:5082] [48588] (2 PDB entries)
  8. 360947Domain d1dgpb_: 1dgp B: [19449]
    complexed with foh

Details for d1dgpb_

PDB Entry: 1dgp (more details), 2.8 Å

PDB Description: aristolochene synthase farnesol complex

SCOP Domain Sequences for d1dgpb_:

Sequence, based on SEQRES records: (download)

>d1dgpb_ a.128.1.4 (B:) Aristolochene synthase {Fungus (Penicillium roqueforti)}
tppptqwsylchprvkevqdevdgyflenwkfpsfkavrtfldakfsevtclyfplaldd
rihfacrlltvlfliddvlehmsfadgeaynnrlipisrgdvlpdrtkpeefilydlwes
mrahdaelanevleptfvfmraqtdrarlsihelghyleyrekdvgkallsalmrfsmgl
rlsadelqdmkaleancakqlsvvndiysydkeeeasrtghkegaflcsavkvlaeeskl
gipatkrvlwsmtrewetvhdeivaekiaspdgcseaakaymkgleyqmsgneqwskttr

Sequence, based on observed residues (ATOM records): (download)

>d1dgpb_ a.128.1.4 (B:) Aristolochene synthase {Fungus (Penicillium roqueforti)}
tppptqwsylchprvkevqdevdgyflenwkfpsfkavrtfldakfsevtclyfplaldd
rihfacrlltvlfliddvlehmsfadgeaynnrlipisrgdvlpdrtkpeefilydlwes
mrahdaelanevleptfvfmraqtdrarlsihelghyleyrekdvgkallsalmrfsmgl
rlsadelqdmkaleancakqlsvvndiysydkeeealcsavkvlaeesklgipatkrvlw
smtrewetvhdeivaekiaspdgcseaakaymkgleyqmsgneqwskttr

SCOP Domain Coordinates for d1dgpb_:

Click to download the PDB-style file with coordinates for d1dgpb_.
(The format of our PDB-style files is described here.)

Timeline for d1dgpb_: