Lineage for d1dgpb_ (1dgp B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010547Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2010548Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2010800Family a.128.1.4: Aristolochene/pentalenene synthase [48586] (3 protein domains)
  6. 2010801Protein Aristolochene synthase [48587] (1 species)
  7. 2010802Species Fungus (Penicillium roqueforti) [TaxId:5082] [48588] (2 PDB entries)
  8. 2010806Domain d1dgpb_: 1dgp B: [19449]
    complexed with foh

Details for d1dgpb_

PDB Entry: 1dgp (more details), 2.8 Å

PDB Description: aristolochene synthase farnesol complex
PDB Compounds: (B:) Aristolochene synthase

SCOPe Domain Sequences for d1dgpb_:

Sequence, based on SEQRES records: (download)

>d1dgpb_ a.128.1.4 (B:) Aristolochene synthase {Fungus (Penicillium roqueforti) [TaxId: 5082]}
tppptqwsylchprvkevqdevdgyflenwkfpsfkavrtfldakfsevtclyfplaldd
rihfacrlltvlfliddvlehmsfadgeaynnrlipisrgdvlpdrtkpeefilydlwes
mrahdaelanevleptfvfmraqtdrarlsihelghyleyrekdvgkallsalmrfsmgl
rlsadelqdmkaleancakqlsvvndiysydkeeeasrtghkegaflcsavkvlaeeskl
gipatkrvlwsmtrewetvhdeivaekiaspdgcseaakaymkgleyqmsgneqwskttr

Sequence, based on observed residues (ATOM records): (download)

>d1dgpb_ a.128.1.4 (B:) Aristolochene synthase {Fungus (Penicillium roqueforti) [TaxId: 5082]}
tppptqwsylchprvkevqdevdgyflenwkfpsfkavrtfldakfsevtclyfplaldd
rihfacrlltvlfliddvlehmsfadgeaynnrlipisrgdvlpdrtkpeefilydlwes
mrahdaelanevleptfvfmraqtdrarlsihelghyleyrekdvgkallsalmrfsmgl
rlsadelqdmkaleancakqlsvvndiysydkeeealcsavkvlaeesklgipatkrvlw
smtrewetvhdeivaekiaspdgcseaakaymkgleyqmsgneqwskttr

SCOPe Domain Coordinates for d1dgpb_:

Click to download the PDB-style file with coordinates for d1dgpb_.
(The format of our PDB-style files is described here.)

Timeline for d1dgpb_: