Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.1: Microbial ribonucleases [53932] (1 superfamily) single helix packs against antiparallel beta-sheet |
Superfamily d.1.1: Microbial ribonucleases [53933] (4 families) |
Family d.1.1.2: Bacterial ribonucleases [81307] (6 proteins) |
Protein automated matches [190834] (2 species) not a true protein |
Species Bacillus intermedius [TaxId:1400] [194484] (1 PDB entry) |
Domain d4haab_: 4haa B: [194485] automated match to d1buja_ mutant |
PDB Entry: 4haa (more details), 1.9 Å
SCOPe Domain Sequences for d4haab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4haab_ d.1.1.2 (B:) automated matches {Bacillus intermedius [TaxId: 1400]} avintfdgvadylirykrlpdnyitksqasalgwvaskgnlaavapgksiggdvfsnreg rlpsasgrtwreadinyvsgarnadrlvyssdwliykttdhyatftrir
Timeline for d4haab_: