Lineage for d4haab_ (4haa B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1886642Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
    single helix packs against antiparallel beta-sheet
  4. 1886643Superfamily d.1.1: Microbial ribonucleases [53933] (4 families) (S)
  5. 1886644Family d.1.1.2: Bacterial ribonucleases [81307] (6 proteins)
  6. 1886839Protein automated matches [190834] (2 species)
    not a true protein
  7. 1886840Species Bacillus intermedius [TaxId:1400] [194484] (1 PDB entry)
  8. 1886842Domain d4haab_: 4haa B: [194485]
    automated match to d1buja_
    mutant

Details for d4haab_

PDB Entry: 4haa (more details), 1.9 Å

PDB Description: Structure of Ribonuclease Binase Glu43Ala/Phe81Ala Mutant
PDB Compounds: (B:) Ribonuclease

SCOPe Domain Sequences for d4haab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4haab_ d.1.1.2 (B:) automated matches {Bacillus intermedius [TaxId: 1400]}
avintfdgvadylirykrlpdnyitksqasalgwvaskgnlaavapgksiggdvfsnreg
rlpsasgrtwreadinyvsgarnadrlvyssdwliykttdhyatftrir

SCOPe Domain Coordinates for d4haab_:

Click to download the PDB-style file with coordinates for d4haab_.
(The format of our PDB-style files is described here.)

Timeline for d4haab_: