Lineage for d4hb7a_ (4hb7 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2089689Superfamily c.1.21: Dihydropteroate synthetase-like [51717] (3 families) (S)
  5. 2089690Family c.1.21.1: Dihydropteroate synthetase [51718] (2 protein domains)
  6. 2089772Protein automated matches [194480] (6 species)
    not a true protein
  7. 2089776Species Staphylococcus aureus [TaxId:158878] [194481] (1 PDB entry)
  8. 2089777Domain d4hb7a_: 4hb7 A: [194483]
    automated match to d1ad1b_
    complexed with edo

Details for d4hb7a_

PDB Entry: 4hb7 (more details), 1.95 Å

PDB Description: the structure of dihydropteroate synthase from staphylococcus aureus subsp. aureus mu50.
PDB Compounds: (A:) dihydropteroate synthase

SCOPe Domain Sequences for d4hb7a_:

Sequence, based on SEQRES records: (download)

>d4hb7a_ c.1.21.1 (A:) automated matches {Staphylococcus aureus [TaxId: 158878]}
tktkimgilnvtpdsfsdggkfnnvetainrvkamidegadiidvggvstrpghemvtle
eelnrvlpvveaivgfdvkisvdtfrsevaeaclklgvdmindqwaglydhrmfqivaky
daeiilmhngngnrdepvveemltsllaqahqakiagipsnkiwldpgigfaktrneeae
vmarldelvateypvllatsrkrftkemmgydttpverdevtaattaygimkgvravrvh
nvelnaklakgidflkenenarh

Sequence, based on observed residues (ATOM records): (download)

>d4hb7a_ c.1.21.1 (A:) automated matches {Staphylococcus aureus [TaxId: 158878]}
tktkimgilnvtnnvetainrvkamidegadiidvggvstrpghemvtleeelnrvlpvv
eaivgfdvkisvdtfrsevaeaclklgvdmindqwaglydhrmfqivakydaeiilmhng
ngnrdepvveemltsllaqahqakiagipsnkiwldpgigfaktrneeaevmarldelva
teypvllatsrkrftkemmgydttpverdevtaattaygimkgvravrvhnvelnaklak
gidflkenenarh

SCOPe Domain Coordinates for d4hb7a_:

Click to download the PDB-style file with coordinates for d4hb7a_.
(The format of our PDB-style files is described here.)

Timeline for d4hb7a_: