Lineage for d4hg9b_ (4hg9 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2015621Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2015622Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2015627Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2015999Protein automated matches [190139] (26 species)
    not a true protein
  7. 2016087Species Halys viper (Agkistrodon halys) [TaxId:8714] [194477] (1 PDB entry)
  8. 2016089Domain d4hg9b_: 4hg9 B: [194479]
    automated match to d1jiaa_
    complexed with ca, cit, g3p, gol

Details for d4hg9b_

PDB Entry: 4hg9 (more details), 1.6 Å

PDB Description: Crystal structure of AhV_bPA, a basic PLA2 from Agkistrodon halys pallas venom
PDB Compounds: (B:) Basic phospholipase A2 B

SCOPe Domain Sequences for d4hg9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hg9b_ a.133.1.2 (B:) automated matches {Halys viper (Agkistrodon halys) [TaxId: 8714]}
hllqfrkmikkmtgkepvvsyafygcycgsggrgkpkdatdrccfvhdccyekvtgcdpk
wddytyswkdgdivcggddpckkevcecdkaaaicfrdnlktykkrymaypdilcsskse
kc

SCOPe Domain Coordinates for d4hg9b_:

Click to download the PDB-style file with coordinates for d4hg9b_.
(The format of our PDB-style files is described here.)

Timeline for d4hg9b_: