SCOPe 2.06: Domain d3u5sa1: 3u5s A:82-205

Lineage for d3u5sa1 (3u5s A:82-205)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.15: FAD-dependent thiol oxidase [69000] (2 families)

5. Family a.24.15.1: FAD-dependent thiol oxidase [69001] (3 proteins)

6. Protein Augmenter of liver regeneration [89018] (2 species)
   a mammalian FAD-dependent sulfhydryl oxidase

7. Species Human (Homo sapiens) [TaxId:9606] [189907] (7 PDB entries)

8. Domain d3u5sa1: 3u5s A:82-205 [194476]
   Other proteins in same PDB: d3u5sa2
   automated match to d3o55a_
   complexed with fad

Details for d3u5sa1

PDB Entry: 3u5s, 1.5 Å

PDB Description: Selenium Substituted Human Augmenter of Liver Regeneration

PDB Compounds: (A:) FAD-linked sulfhydryl oxidase ALR

SCOPe Domain Sequences for d3u5sa1:

Sequence; same for both SEQRES and ATOM records:

>d3u5sa1 a.24.15.1 (A:82-205) Augmenter of liver regeneration {Human (Homo sapiens) [TaxId: 9606]}
rtqqkrdtkfredappdreelgrhswavlhtlaayypdlptpeqqqdmaqfihlfskfyp
aeeaaedlrkrlarnhpdtrtraaftqwlahlhnevnrklgkpdfdaskvderwrdgwkd
gsad

Timeline for d3u5sa1:

• d3u5sa1 first appeared in SCOPe 2.02, called d3u5sa_
  
• d3u5sa1 was called d3u5sa_ in SCOPe 2.05
  
• d3u5sa1 appears in SCOPe 2.07
  
• d3u5sa1 appears in the current release, SCOPe 2.08