Lineage for d3u5sa1 (3u5s A:82-205)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2700461Superfamily a.24.15: FAD-dependent thiol oxidase [69000] (2 families) (S)
  5. 2700462Family a.24.15.1: FAD-dependent thiol oxidase [69001] (3 proteins)
  6. 2700463Protein Augmenter of liver regeneration [89018] (2 species)
    a mammalian FAD-dependent sulfhydryl oxidase
  7. 2700464Species Human (Homo sapiens) [TaxId:9606] [189907] (7 PDB entries)
  8. 2700466Domain d3u5sa1: 3u5s A:82-205 [194476]
    Other proteins in same PDB: d3u5sa2
    automated match to d3o55a_
    complexed with fad

Details for d3u5sa1

PDB Entry: 3u5s (more details), 1.5 Å

PDB Description: Selenium Substituted Human Augmenter of Liver Regeneration
PDB Compounds: (A:) FAD-linked sulfhydryl oxidase ALR

SCOPe Domain Sequences for d3u5sa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3u5sa1 a.24.15.1 (A:82-205) Augmenter of liver regeneration {Human (Homo sapiens) [TaxId: 9606]}
rtqqkrdtkfredappdreelgrhswavlhtlaayypdlptpeqqqdmaqfihlfskfyp
aeeaaedlrkrlarnhpdtrtraaftqwlahlhnevnrklgkpdfdaskvderwrdgwkd
gsad

SCOPe Domain Coordinates for d3u5sa1:

Click to download the PDB-style file with coordinates for d3u5sa1.
(The format of our PDB-style files is described here.)

Timeline for d3u5sa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3u5sa2