| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.15: FAD-dependent thiol oxidase [69000] (2 families) ![]() |
| Family a.24.15.1: FAD-dependent thiol oxidase [69001] (3 proteins) |
| Protein Augmenter of liver regeneration [89018] (2 species) a mammalian FAD-dependent sulfhydryl oxidase |
| Species Human (Homo sapiens) [TaxId:9606] [189907] (7 PDB entries) |
| Domain d3u5sa1: 3u5s A:82-205 [194476] Other proteins in same PDB: d3u5sa2 automated match to d3o55a_ complexed with fad |
PDB Entry: 3u5s (more details), 1.5 Å
SCOPe Domain Sequences for d3u5sa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3u5sa1 a.24.15.1 (A:82-205) Augmenter of liver regeneration {Human (Homo sapiens) [TaxId: 9606]}
rtqqkrdtkfredappdreelgrhswavlhtlaayypdlptpeqqqdmaqfihlfskfyp
aeeaaedlrkrlarnhpdtrtraaftqwlahlhnevnrklgkpdfdaskvderwrdgwkd
gsad
Timeline for d3u5sa1: