SCOPe 2.08: Domain d3u8ia_: 3u8i A:

Lineage for d3u8ia_ (3u8i A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
   automatically mapped to Pfam PF00068

6. Protein Phospholipase A2 [48637] (5 species)

7. Species Human (Homo sapiens), synovial fluid [TaxId:9606] [48638] (16 PDB entries)

8. Domain d3u8ia_: 3u8i A: [194471]
   automated match to d1kvoa_
   complexed with ca, cl, na

Details for d3u8ia_

PDB Entry: 3u8i, 1.1 Å

PDB Description: Functionally selective inhibition of Group IIA phospholipase A2 reveals a role for vimentin in regulating arachidonic acid metabolism

PDB Compounds: (A:) Phospholipase A2, membrane associated

SCOPe Domain Sequences for d3u8ia_:

Sequence; same for both SEQRES and ATOM records:

>d3u8ia_ a.133.1.2 (A:) Phospholipase A2 {Human (Homo sapiens), synovial fluid [TaxId: 9606]}
nlvnfhrmiklttgkeaalsygfygchcgvggrgspkdatdrccvtxdccykrlekrgcg
tkflsykfsnsgsritcakqdscrsqlcecdkaaatcfarnkttynkkyqyysnkhcrgs
tprc

Timeline for d3u8ia_:

• d3u8ia_ first appeared in SCOPe 2.02
  
• d3u8ia_ appears in SCOPe 2.07