Lineage for d3vupa_ (3vup A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1818156Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1820295Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 1820296Protein automated matches [190075] (72 species)
    not a true protein
  7. 1820308Species Aplysia kurodai [TaxId:6501] [194466] (1 PDB entry)
  8. 1820309Domain d3vupa_: 3vup A: [194468]
    automated match to d2c0ha1
    complexed with so4, trs

Details for d3vupa_

PDB Entry: 3vup (more details), 1.05 Å

PDB Description: Beta-1,4-mannanase from the common sea hare Aplysia kurodai
PDB Compounds: (A:) beta-1,4-mannanase

SCOPe Domain Sequences for d3vupa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vupa_ c.1.8.0 (A:) automated matches {Aplysia kurodai [TaxId: 6501]}
rlhiqnghfvlngqrvflsggnlpwmsyaydfgdgqwqrnknriepefkklhdaggnsmr
lwihiqgettpafndqgfvtgpdkqgtmlddmkdlldtakkynilvfpclwnaavnqdsh
nrldglikdqhklqsyidkalkpivnhvkghvalggwdlmnepegmmipdkhnaekcydt
talknsgagwagnkylyqdilrflnwqadaikttdpgalvtmgvwnpksntdhfnmnnhy
sdhclrlaggkqkgvfdfyqfhsyswqgkwdevapfthqasdyglhkpivvgefweqdgg
gmtitqmfnyvynhgyagawswhlvqrgdnqrkgitnikdktsngkipisl

SCOPe Domain Coordinates for d3vupa_:

Click to download the PDB-style file with coordinates for d3vupa_.
(The format of our PDB-style files is described here.)

Timeline for d3vupa_: