SCOPe 2.07: Domain d3vupb_: 3vup B:

Lineage for d3vupb_ (3vup B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.0: automated matches [191314] (1 protein)
   not a true family

6. Protein automated matches [190075] (125 species)
   not a true protein

7. Species Aplysia kurodai [TaxId:6501] [194466] (1 PDB entry)

8. Domain d3vupb_: 3vup B: [194467]
   automated match to d2c0ha1
   complexed with so4, trs

Details for d3vupb_

PDB Entry: 3vup, 1.05 Å

PDB Description: Beta-1,4-mannanase from the common sea hare Aplysia kurodai

PDB Compounds: (B:) beta-1,4-mannanase

SCOPe Domain Sequences for d3vupb_:

Sequence; same for both SEQRES and ATOM records:

>d3vupb_ c.1.8.0 (B:) automated matches {Aplysia kurodai [TaxId: 6501]}
rlhiqnghfvlngqrvflsggnlpwmsyaydfgdgqwqrnknriepefkklhdaggnsmr
lwihiqgettpafndqgfvtgpdkqgtmlddmkdlldtakkynilvfpclwnaavnqdsh
nrldglikdqhklqsyidkalkpivnhvkghvalggwdlmnepegmmipdkhnaekcydt
talknsgagwagnkylyqdilrflnwqadaikttdpgalvtmgvwnpksntdhfnmnnhy
sdhclrlaggkqkgvfdfyqfhsyswqgkwdevapfthqasdyglhkpivvgefweqdgg
gmtitqmfnyvynhgyagawswhlvqrgdnqrkgitnikdktsngkipisl

Timeline for d3vupb_:

• d3vupb_ first appeared in SCOPe 2.02
  
• d3vupb_ appears in SCOPe 2.06
  
• d3vupb_ appears in the current release, SCOPe 2.08