Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
Protein automated matches [190075] (90 species) not a true protein |
Species Aplysia kurodai [TaxId:6501] [194466] (1 PDB entry) |
Domain d3vupb_: 3vup B: [194467] automated match to d2c0ha1 complexed with so4, trs |
PDB Entry: 3vup (more details), 1.05 Å
SCOPe Domain Sequences for d3vupb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vupb_ c.1.8.0 (B:) automated matches {Aplysia kurodai [TaxId: 6501]} rlhiqnghfvlngqrvflsggnlpwmsyaydfgdgqwqrnknriepefkklhdaggnsmr lwihiqgettpafndqgfvtgpdkqgtmlddmkdlldtakkynilvfpclwnaavnqdsh nrldglikdqhklqsyidkalkpivnhvkghvalggwdlmnepegmmipdkhnaekcydt talknsgagwagnkylyqdilrflnwqadaikttdpgalvtmgvwnpksntdhfnmnnhy sdhclrlaggkqkgvfdfyqfhsyswqgkwdevapfthqasdyglhkpivvgefweqdgg gmtitqmfnyvynhgyagawswhlvqrgdnqrkgitnikdktsngkipisl
Timeline for d3vupb_: