![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.22: TNF-like [49841] (1 superfamily) sandwich, 10 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.22.1: TNF-like [49842] (2 families) ![]() |
![]() | Family b.22.1.1: TNF-like [49843] (15 proteins) |
![]() | Protein TRANCE/RANKL cytokine [63721] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [63722] (6 PDB entries) |
![]() | Domain d4e4dx_: 4e4d X: [194463] automated match to d1s55a_ complexed with cl |
PDB Entry: 4e4d (more details), 2.7 Å
SCOPe Domain Sequences for d4e4dx_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4e4dx_ b.22.1.1 (X:) TRANCE/RANKL cytokine {Mouse (Mus musculus) [TaxId: 10090]} qpfahltinaasipsgshkvtlsswyhdrgwakisnmtlsngklrvnqdgfyylyanicf rhhetsgsvptdylqlmvyvvktsikipsshnlmkggstknwsgnsefhfysinvggffk lrageeisiqvsnpslldpdqdatyfgafkvqdi
Timeline for d4e4dx_: