Lineage for d4e4dx_ (4e4d X:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2777171Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2777172Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 2777173Family b.22.1.1: TNF-like [49843] (15 proteins)
  6. 2777375Protein TRANCE/RANKL cytokine [63721] (1 species)
  7. 2777376Species Mouse (Mus musculus) [TaxId:10090] [63722] (6 PDB entries)
  8. 2777390Domain d4e4dx_: 4e4d X: [194463]
    automated match to d1s55a_
    complexed with cl

Details for d4e4dx_

PDB Entry: 4e4d (more details), 2.7 Å

PDB Description: crystal structure of mouse rankl-opg complex
PDB Compounds: (X:) Tumor necrosis factor ligand superfamily member 11, soluble form

SCOPe Domain Sequences for d4e4dx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4e4dx_ b.22.1.1 (X:) TRANCE/RANKL cytokine {Mouse (Mus musculus) [TaxId: 10090]}
qpfahltinaasipsgshkvtlsswyhdrgwakisnmtlsngklrvnqdgfyylyanicf
rhhetsgsvptdylqlmvyvvktsikipsshnlmkggstknwsgnsefhfysinvggffk
lrageeisiqvsnpslldpdqdatyfgafkvqdi

SCOPe Domain Coordinates for d4e4dx_:

Click to download the PDB-style file with coordinates for d4e4dx_.
(The format of our PDB-style files is described here.)

Timeline for d4e4dx_: