![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
![]() | Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
![]() | Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins) |
![]() | Protein automated matches [190113] (17 species) not a true protein |
![]() | Species Leishmania major [TaxId:5664] [194459] (2 PDB entries) |
![]() | Domain d4gedb_: 4ged B: [194460] automated match to d2yk3a_ complexed with hec, hem, k, mg |
PDB Entry: 4ged (more details), 1.84 Å
SCOPe Domain Sequences for d4gedb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gedb_ a.3.1.1 (B:) automated matches {Leishmania major [TaxId: 5664]} gdvergeklfkgraaqchtatkggsngvgpnlfgivnrpsgkvegftyskanaesgviwt pevldvylenpkkfmpgtkmsfagikkpqeradviayletlk
Timeline for d4gedb_: