Lineage for d4gedb_ (4ged B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2690796Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2690797Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2690798Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 2691317Protein automated matches [190113] (17 species)
    not a true protein
  7. 2691335Species Leishmania major [TaxId:5664] [194459] (2 PDB entries)
  8. 2691336Domain d4gedb_: 4ged B: [194460]
    automated match to d2yk3a_
    complexed with hec, hem, k, mg

Details for d4gedb_

PDB Entry: 4ged (more details), 1.84 Å

PDB Description: Crystal Structure of the Leishmania Major Peroxidase-Cytochrome C Complex
PDB Compounds: (B:) cytochrome c

SCOPe Domain Sequences for d4gedb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gedb_ a.3.1.1 (B:) automated matches {Leishmania major [TaxId: 5664]}
gdvergeklfkgraaqchtatkggsngvgpnlfgivnrpsgkvegftyskanaesgviwt
pevldvylenpkkfmpgtkmsfagikkpqeradviayletlk

SCOPe Domain Coordinates for d4gedb_:

Click to download the PDB-style file with coordinates for d4gedb_.
(The format of our PDB-style files is described here.)

Timeline for d4gedb_: