Lineage for d4giqa_ (4giq A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779160Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 1779161Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 1779162Family b.22.1.1: TNF-like [49843] (15 proteins)
  6. 1779409Protein automated matches [190204] (3 species)
    not a true protein
  7. 1779436Species Mouse (Mus musculus) [TaxId:10090] [189134] (3 PDB entries)
  8. 1779437Domain d4giqa_: 4giq A: [194458]
    automated match to d1s55a_
    complexed with cl, na, nag

Details for d4giqa_

PDB Entry: 4giq (more details), 2.7 Å

PDB Description: crystal structure of mouse rank bound to rankl
PDB Compounds: (A:) tumor necrosis factor ligand superfamily member 11

SCOPe Domain Sequences for d4giqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4giqa_ b.22.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qpfahltinaasipsgshkvtlsswyhdrgwakisnmtlsngklrvnqdgfyylyanicf
rhhetsgsvptdylqlmvyvvktsikipsshnlmkggstknwsgnsefhfysinvggffk
lrageeisiqvsnpslldpdqdatyfgafkvqdid

SCOPe Domain Coordinates for d4giqa_:

Click to download the PDB-style file with coordinates for d4giqa_.
(The format of our PDB-style files is described here.)

Timeline for d4giqa_: