| Class b: All beta proteins [48724] (180 folds) |
| Fold b.22: TNF-like [49841] (1 superfamily) sandwich, 10 strands in 2 sheets; jelly-roll |
Superfamily b.22.1: TNF-like [49842] (2 families) ![]() |
| Family b.22.1.1: TNF-like [49843] (15 proteins) |
| Protein automated matches [190204] (3 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [189134] (3 PDB entries) |
| Domain d4giqa_: 4giq A: [194458] automated match to d1s55a_ complexed with cl, na, nag |
PDB Entry: 4giq (more details), 2.7 Å
SCOPe Domain Sequences for d4giqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4giqa_ b.22.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qpfahltinaasipsgshkvtlsswyhdrgwakisnmtlsngklrvnqdgfyylyanicf
rhhetsgsvptdylqlmvyvvktsikipsshnlmkggstknwsgnsefhfysinvggffk
lrageeisiqvsnpslldpdqdatyfgafkvqdid
Timeline for d4giqa_: