Lineage for d4gtvb_ (4gtv B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004058Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2004426Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) (S)
  5. 2004554Family a.102.4.3: Protein prenyltransferases [48246] (3 protein domains)
  6. 2004671Protein Rab geranylgeranyltransferase, beta subunit [48249] (1 species)
  7. 2004672Species Norway rat (Rattus norvegicus) [TaxId:10116] [48250] (21 PDB entries)
  8. 2004675Domain d4gtvb_: 4gtv B: [194457]
    automated match to d1dceb_
    complexed with 7tr, ca, zn

Details for d4gtvb_

PDB Entry: 4gtv (more details), 1.95 Å

PDB Description: engineered rabggtase in complex with bms analogue 13
PDB Compounds: (B:) Geranylgeranyl transferase type-2 subunit beta

SCOPe Domain Sequences for d4gtvb_:

Sequence, based on SEQRES records: (download)

>d4gtvb_ a.102.4.3 (B:) Rab geranylgeranyltransferase, beta subunit {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qkdvtiksdapdtlllekhadyiasygskkddyeycmseylrmsgvywgltvmdlmgqlh
rmnkeeilvfikscqhecggvsasighdphllytlsavqiltlydsihvinvdkvvayvq
slqkedgsfagdiwgeidtrfsfcavatlallgkldainvekaiefvlscmnfdggfgcr
pgseshagqiycctgflaitsqlhqvnsdllgwwlcerqlpsgglngrpeklpdvcysww
vlaslkiigrlhwidreklrsfilacqdeetggfadrpgdmvdpfhtlfgiaglsllgee
qikpvspvfcmpeevlqrvnvqpelvs

Sequence, based on observed residues (ATOM records): (download)

>d4gtvb_ a.102.4.3 (B:) Rab geranylgeranyltransferase, beta subunit {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qkdvtiksdapdtlllekhadyiasygsdyeycmseylrmsgvywgltvmdlmgqlhrmn
keeilvfikscqhecggvsasighdphllytlsavqiltlydsihvinvdkvvayvqslq
kedgsfagdiwgeidtrfsfcavatlallgkldainvekaiefvlscmnfdggfgcrpgs
eshagqiycctgflaitsqlhqvnsdllgwwlcerqlpsgglngrpeklpdvcyswwvla
slkiigrlhwidreklrsfilacqdeetggfadrpgdmvdpfhtlfgiaglsllgeeqik
pvspvfcmpeevlqrvnvqpelvs

SCOPe Domain Coordinates for d4gtvb_:

Click to download the PDB-style file with coordinates for d4gtvb_.
(The format of our PDB-style files is described here.)

Timeline for d4gtvb_: