SCOPe 2.08: Domain d4h3ma_: 4h3m A:

Lineage for d4h3ma_ (4h3m A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein automated matches [190406] (19 species)
   not a true protein

7. Species Discosoma sp. [TaxId:301246] [188540] (5 PDB entries)

8. Domain d4h3ma_: 4h3m A: [194454]
   automated match to d3nf0a_

Details for d4h3ma_

PDB Entry: 4h3m, 2 Å

PDB Description: mplumayc-e16a

PDB Compounds: (A:) Fluorescent protein plum

SCOPe Domain Sequences for d4h3ma_:

Sequence; same for both SEQRES and ATOM records:

>d4h3ma_ d.22.1.1 (A:) automated matches {Discosoma sp. [TaxId: 301246]}
evikefmrfkahmegsvnghefeiegegegrpyegtqtarlkvtkggplpfawdilspqi
mygskayvkhpadipdylklsfpegfkwervmnfedggvvtvtqdsslqdgefiykvkvr
gtnfpsdgpvmqkktmgweassermypedgalkgemkmrlrlkdgghydaevkttymakk
pvqlpgaykadyklditshnedytiveqyercegr

Timeline for d4h3ma_:

• d4h3ma_ first appeared in SCOPe 2.02
  
• d4h3ma_ appears in SCOPe 2.07