SCOPe 2.07: Domain d4hdea1: 4hde A:29-195

Lineage for d4hdea1 (4hde A:29-195)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (188 species)
   not a true protein

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [194451] (2 PDB entries)

8. Domain d4hdea1: 4hde A:29-195 [194452]
   Other proteins in same PDB: d4hdea2
   automated match to d1on4a_

Details for d4hdea1

PDB Entry: 4hde, 1.32 Å

PDB Description: The crystal structure of a SCO1/SenC family lipoprotein from Bacillus anthracis str. Ames

PDB Compounds: (A:) SCO1/SenC family lipoprotein

SCOPe Domain Sequences for d4hdea1:

Sequence; same for both SEQRES and ATOM records:

>d4hdea1 c.47.1.0 (A:29-195) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
lrkplnwdletfqftnqdgkpfgtkdlkgkvwvadfmftncqtvcppmtanmaklqkmak
eekldvqfvsfsvdpdldkpenlkafiqkftedtsnwnlltgysleditkfskdnfqslv
dkpengqvihgtsfylidqngkvmkkysgisntpyediirdmkrlae

Timeline for d4hdea1:

• d4hdea1 first appeared in SCOPe 2.02, called d4hdea_
  
• d4hdea1 appears in SCOPe 2.06
  
• d4hdea1 appears in the current release, SCOPe 2.08