| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
| Protein automated matches [190056] (195 species) not a true protein |
| Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [194451] (2 PDB entries) |
| Domain d4hdea1: 4hde A:29-195 [194452] Other proteins in same PDB: d4hdea2 automated match to d1on4a_ |
PDB Entry: 4hde (more details), 1.32 Å
SCOPe Domain Sequences for d4hdea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hdea1 c.47.1.0 (A:29-195) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
lrkplnwdletfqftnqdgkpfgtkdlkgkvwvadfmftncqtvcppmtanmaklqkmak
eekldvqfvsfsvdpdldkpenlkafiqkftedtsnwnlltgysleditkfskdnfqslv
dkpengqvihgtsfylidqngkvmkkysgisntpyediirdmkrlae
Timeline for d4hdea1: