SCOP 1.55: Domain d5eat_2: 5eat 221-548

Lineage for d5eat_2 (5eat 221-548)

1. Root: SCOP 1.55

2. Class a: All alpha proteins [46456] (138 folds)

3. Fold a.128: Terpenoid synthases [48575] (1 superfamily)

4. Superfamily a.128.1: Terpenoid synthases [48576] (4 families)

5. Family a.128.1.3: 5-Epi-aristolochene synthase, C-terminal domain [48583] (1 protein)

6. Protein 5-Epi-aristolochene synthase, C-terminal domain [48584] (1 species)

7. Species Tobacco (Nicotiana tabacum) [TaxId:4097] [48585] (3 PDB entries)

8. Domain d5eat_2: 5eat 221-548 [19445]
   Other proteins in same PDB: d5eat_1

Details for d5eat_2

PDB Entry: 5eat, 2.8 Å

PDB Description: 5-epi-aristolochene synthase from nicotiana tabacum with substrate analog farnesyl hydroxyphosphonate

SCOP Domain Sequences for d5eat_2:

Sequence; same for both SEQRES and ATOM records:

>d5eat_2 a.128.1.3 (221-548) 5-Epi-aristolochene synthase, C-terminal domain {Tobacco (Nicotiana tabacum)}
knnvllrfakldfnllqmlhkqelaqvsrwwkdldfvttlpyardrvvecyfwalgvyfe
pqysqarvmlvktismisivddtfdaygtvkeleaytdaiqrwdineidrlpdymkisyk
aildlykdyekelssagrshivchaiermkevvrnynvestwfiegytppvseylsnala
tttyyylattsylgmksateqdfewlsknpkileasviicrviddtatyeveksrgqiat
gieccmrdygistkeamakfqnmaetawkdinegllrptpvstefltpilnlarivevty
ihnldgythpeevlkphiinllvdsiki

Timeline for d5eat_2:

• d5eat_2 appears in SCOP 1.57
  
• d5eat_2 appears in the current release, SCOPe 2.08, called d5eata2