SCOPe 2.08: Domain d5eata2: 5eat A:221-548

Lineage for d5eata2 (5eat A:221-548)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.128: Terpenoid synthases [48575] (1 superfamily)
   multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers

4. Superfamily a.128.1: Terpenoid synthases [48576] (6 families)
   duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J

5. Family a.128.1.3: Terpenoid cyclase C-terminal domain [48583] (3 proteins)
   automatically mapped to Pfam PF03936

6. Protein 5-Epi-aristolochene synthase [48584] (1 species)

7. Species Tobacco (Nicotiana tabacum) [TaxId:4097] [48585] (7 PDB entries)

8. Domain d5eata2: 5eat A:221-548 [19445]
   Other proteins in same PDB: d5eata1
   complexed with fhp, mg

Details for d5eata2

PDB Entry: 5eat, 2.8 Å

PDB Description: 5-epi-aristolochene synthase from nicotiana tabacum with substrate analog farnesyl hydroxyphosphonate

PDB Compounds: (A:) 5-epi-aristolochene synthase

SCOPe Domain Sequences for d5eata2:

Sequence; same for both SEQRES and ATOM records:

>d5eata2 a.128.1.3 (A:221-548) 5-Epi-aristolochene synthase {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
knnvllrfakldfnllqmlhkqelaqvsrwwkdldfvttlpyardrvvecyfwalgvyfe
pqysqarvmlvktismisivddtfdaygtvkeleaytdaiqrwdineidrlpdymkisyk
aildlykdyekelssagrshivchaiermkevvrnynvestwfiegytppvseylsnala
tttyyylattsylgmksateqdfewlsknpkileasviicrviddtatyeveksrgqiat
gieccmrdygistkeamakfqnmaetawkdinegllrptpvstefltpilnlarivevty
ihnldgythpeevlkphiinllvdsiki

Timeline for d5eata2:

• d5eata2 first appeared (with stable ids) in SCOP 1.55, called d5eat_2
  
• d5eata2 appears in SCOPe 2.07