| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.15: Xylose isomerase-like [51658] (8 families) ![]() different families share similar but non-identical metal-binding sites |
| Family c.1.15.4: IolI-like [75090] (3 proteins) |
| Protein Putative cytoplasmic protein STM4435 [159419] (1 species) |
| Species Salmonella typhimurium [TaxId:90371] [159420] (2 PDB entries) Uniprot Q8ZK48 1-271 |
| Domain d4hgxb_: 4hgx B: [194449] automated match to d2q02a1 complexed with act, zn |
PDB Entry: 4hgx (more details), 2.6 Å
SCOPe Domain Sequences for d4hgxb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hgxb_ c.1.15.4 (B:) Putative cytoplasmic protein STM4435 {Salmonella typhimurium [TaxId: 90371]}
mniektrfcinrkiapglsieaffrlvkrlefnkvelrndmpsgsvtddlnynqvrnlae
kygleivtinavypfnqlteevvkktegllrdaqgvgaralvlcplndgtivppevtvea
ikrlsdlfarydiqglveplgfrvsslrsavwaqqlireagspfkvlldtfhhhlyeeae
kefasridisaiglvhlsgvedtrptealadeqrimlsekdvmqnyqqvqrlenmgyrgi
yafepfssqlaswseaeieeqinrsvslllq
Timeline for d4hgxb_: