Lineage for d4hgxb_ (4hgx B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2839044Superfamily c.1.15: Xylose isomerase-like [51658] (8 families) (S)
    different families share similar but non-identical metal-binding sites
  5. 2839386Family c.1.15.4: IolI-like [75090] (3 proteins)
  6. 2839395Protein Putative cytoplasmic protein STM4435 [159419] (1 species)
  7. 2839396Species Salmonella typhimurium [TaxId:90371] [159420] (2 PDB entries)
    Uniprot Q8ZK48 1-271
  8. 2839398Domain d4hgxb_: 4hgx B: [194449]
    automated match to d2q02a1
    complexed with act, zn

Details for d4hgxb_

PDB Entry: 4hgx (more details), 2.6 Å

PDB Description: crystal structure of xylose isomerase domain containing protein (stm4435) from salmonella typhimurium lt2 with unknown ligand
PDB Compounds: (B:) Xylose isomerase domain containing protein

SCOPe Domain Sequences for d4hgxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hgxb_ c.1.15.4 (B:) Putative cytoplasmic protein STM4435 {Salmonella typhimurium [TaxId: 90371]}
mniektrfcinrkiapglsieaffrlvkrlefnkvelrndmpsgsvtddlnynqvrnlae
kygleivtinavypfnqlteevvkktegllrdaqgvgaralvlcplndgtivppevtvea
ikrlsdlfarydiqglveplgfrvsslrsavwaqqlireagspfkvlldtfhhhlyeeae
kefasridisaiglvhlsgvedtrptealadeqrimlsekdvmqnyqqvqrlenmgyrgi
yafepfssqlaswseaeieeqinrsvslllq

SCOPe Domain Coordinates for d4hgxb_:

Click to download the PDB-style file with coordinates for d4hgxb_.
(The format of our PDB-style files is described here.)

Timeline for d4hgxb_: