SCOPe 2.06: Domain d4hgxa_: 4hgx A:

Lineage for d4hgxa_ (4hgx A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.15: Xylose isomerase-like [51658] (8 families)
   different families share similar but non-identical metal-binding sites

5. Family c.1.15.4: IolI-like [75090] (3 proteins)

6. Protein Putative cytoplasmic protein STM4435 [159419] (1 species)

7. Species Salmonella typhimurium [TaxId:90371] [159420] (2 PDB entries)
   Uniprot Q8ZK48 1-271

8. Domain d4hgxa_: 4hgx A: [194448]
   automated match to d2q02a1
   complexed with act, zn

Details for d4hgxa_

PDB Entry: 4hgx, 2.6 Å

PDB Description: crystal structure of xylose isomerase domain containing protein (stm4435) from salmonella typhimurium lt2 with unknown ligand

PDB Compounds: (A:) Xylose isomerase domain containing protein

SCOPe Domain Sequences for d4hgxa_:

Sequence; same for both SEQRES and ATOM records:

>d4hgxa_ c.1.15.4 (A:) Putative cytoplasmic protein STM4435 {Salmonella typhimurium [TaxId: 90371]}
mniektrfcinrkiapglsieaffrlvkrlefnkvelrndmpsgsvtddlnynqvrnlae
kygleivtinavypfnqlteevvkktegllrdaqgvgaralvlcplndgtivppevtvea
ikrlsdlfarydiqglveplgfrvsslrsavwaqqlireagspfkvlldtfhhhlyeeae
kefasridisaiglvhlsgvedtrptealadeqrimlsekdvmqnyqqvqrlenmgyrgi
yafepfssqlaswseaeieeqinrsvsl

Timeline for d4hgxa_:

• d4hgxa_ first appeared in SCOPe 2.02
  
• d4hgxa_ appears in SCOPe 2.05
  
• d4hgxa_ appears in SCOPe 2.07
  
• d4hgxa_ appears in the current release, SCOPe 2.08