SCOPe 2.08: Domain d4a4pa_: 4a4p A:

Lineage for d4a4pa_ (4a4p A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.3: Sec7 domain [48425] (2 families)

5. Family a.118.3.1: Sec7 domain [48426] (6 proteins)
   Pfam PF01369

6. Protein automated matches [194433] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [194434] (2 PDB entries)

8. Domain d4a4pa_: 4a4p A: [194436]
   automated match to d1bc9a_
   complexed with gol

Details for d4a4pa_

PDB Entry: 4a4p, 2 Å

PDB Description: crystal structure of the Sec7 domain from human cytohesin1

PDB Compounds: (A:) cytohesin1

SCOPe Domain Sequences for d4a4pa_:

Sequence; same for both SEQRES and ATOM records:

>d4a4pa_ a.118.3.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nkqvamgrkkfnmdpkkgiqfliendllkntcediaqflykgeglnktaigdylgerdef
niqvlhafvelheftdlnlvqalrqflwsfrlpgeaqkidrmmeafaqrycqcnngvfqs
tdtcyvlsfaiimlntslhnpnvkdkptverfiamnrgindggdlpeellrnlyesikne
pfkipe

Timeline for d4a4pa_:

• d4a4pa_ first appeared in SCOPe 2.02
  
• d4a4pa_ appears in SCOPe 2.07