![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.3: Sec7 domain [48425] (2 families) ![]() |
![]() | Family a.118.3.1: Sec7 domain [48426] (6 proteins) Pfam PF01369 |
![]() | Protein automated matches [194433] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [194434] (1 PDB entry) |
![]() | Domain d4a4pb_: 4a4p B: [194435] automated match to d1bc9a_ complexed with gol |
PDB Entry: 4a4p (more details), 2 Å
SCOPe Domain Sequences for d4a4pb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4a4pb_ a.118.3.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} nkqvamgrkkfnmdpkkgiqfliendllkntcediaqflykgeglnktaigdylgerdef niqvlhafvelheftdlnlvqalrqflwsfrlpgeaqkidrmmeafaqrycqcnngvfqs tdtcyvlsfaiimlntslhnpnvkdkptverfiamnrgindggdlpeellrnlyesikne pfkipe
Timeline for d4a4pb_: