Lineage for d4a4pb_ (4a4p B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2726245Superfamily a.118.3: Sec7 domain [48425] (2 families) (S)
  5. 2726246Family a.118.3.1: Sec7 domain [48426] (6 proteins)
    Pfam PF01369
  6. 2726276Protein automated matches [194433] (2 species)
    not a true protein
  7. 2726277Species Human (Homo sapiens) [TaxId:9606] [194434] (2 PDB entries)
  8. 2726279Domain d4a4pb_: 4a4p B: [194435]
    automated match to d1bc9a_
    complexed with gol

Details for d4a4pb_

PDB Entry: 4a4p (more details), 2 Å

PDB Description: crystal structure of the Sec7 domain from human cytohesin1
PDB Compounds: (B:) cytohesin1

SCOPe Domain Sequences for d4a4pb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a4pb_ a.118.3.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nkqvamgrkkfnmdpkkgiqfliendllkntcediaqflykgeglnktaigdylgerdef
niqvlhafvelheftdlnlvqalrqflwsfrlpgeaqkidrmmeafaqrycqcnngvfqs
tdtcyvlsfaiimlntslhnpnvkdkptverfiamnrgindggdlpeellrnlyesikne
pfkipe

SCOPe Domain Coordinates for d4a4pb_:

Click to download the PDB-style file with coordinates for d4a4pb_.
(The format of our PDB-style files is described here.)

Timeline for d4a4pb_: