SCOPe 2.07: Domain d4ajaa_: 4aja A:

Lineage for d4ajaa_ (4aja A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
   consists of two intertwined (sub)domains related by pseudo dyad; duplication
   3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest

4. Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families)
   the constituent families form similar dimers

5. Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
   the active site is between the two identical subunits

6. Protein automated matches [190072] (22 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [193425] (5 PDB entries)

8. Domain d4ajaa_: 4aja A: [194429]
   automated match to d1pb1a_
   complexed with ca, ict, so4, tap

Details for d4ajaa_

PDB Entry: 4aja, 1.8 Å

PDB Description: 3D structure of E. coli Isocitrate Dehydrogenase in complex with Isocitrate, calcium(II) and thioNADP

PDB Compounds: (A:) NADP Isocitrate dehydrogenase

SCOPe Domain Sequences for d4ajaa_:

Sequence; same for both SEQRES and ATOM records:

>d4ajaa_ c.77.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
eskvvvpaqgkkitlqngklnvpenpiipyiegdgigvdvtpamlkvvdaavekaykger
kiswmeiytgekstqvygqdvwlpaetldlireyrvaikgplttpvgggirslnvalrqe
ldlyiclrpvryyqgtpspvkhpeltdmvifrensediyagiewkadsadaekvikflre
emgvkkirfpehcgigikpcseegtkrlvraaieyaiandrdsvtlvhkgnimkftegaf
kdwgyqlareefggelidggpwlkvknpntgkeivikdviadaflqqillrpaeydviac
mnlngdyisdalaaqvggigiapganigdecalfeathgtapkyagqdkvnpgsiilsae
mmlrhmgwteaadlivkgmegainaktvtydferlmdgakllkcsefgdaiienm

Timeline for d4ajaa_:

• d4ajaa_ first appeared in SCOPe 2.02
  
• d4ajaa_ appears in SCOPe 2.06
  
• d4ajaa_ appears in the current release, SCOPe 2.08