Lineage for d4ajaa_ (4aja A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2905791Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2905792Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 2905793Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
    the active site is between the two identical subunits
  6. 2905990Protein automated matches [190072] (22 species)
    not a true protein
  7. 2906051Species Escherichia coli [TaxId:562] [193425] (5 PDB entries)
  8. 2906053Domain d4ajaa_: 4aja A: [194429]
    automated match to d1pb1a_
    complexed with ca, ict, so4, tap

Details for d4ajaa_

PDB Entry: 4aja (more details), 1.8 Å

PDB Description: 3D structure of E. coli Isocitrate Dehydrogenase in complex with Isocitrate, calcium(II) and thioNADP
PDB Compounds: (A:) NADP Isocitrate dehydrogenase

SCOPe Domain Sequences for d4ajaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ajaa_ c.77.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
eskvvvpaqgkkitlqngklnvpenpiipyiegdgigvdvtpamlkvvdaavekaykger
kiswmeiytgekstqvygqdvwlpaetldlireyrvaikgplttpvgggirslnvalrqe
ldlyiclrpvryyqgtpspvkhpeltdmvifrensediyagiewkadsadaekvikflre
emgvkkirfpehcgigikpcseegtkrlvraaieyaiandrdsvtlvhkgnimkftegaf
kdwgyqlareefggelidggpwlkvknpntgkeivikdviadaflqqillrpaeydviac
mnlngdyisdalaaqvggigiapganigdecalfeathgtapkyagqdkvnpgsiilsae
mmlrhmgwteaadlivkgmegainaktvtydferlmdgakllkcsefgdaiienm

SCOPe Domain Coordinates for d4ajaa_:

Click to download the PDB-style file with coordinates for d4ajaa_.
(The format of our PDB-style files is described here.)

Timeline for d4ajaa_: