![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
![]() | Superfamily d.22.1: GFP-like [54511] (3 families) ![]() |
![]() | Family d.22.1.1: Fluorescent proteins [54512] (6 proteins) |
![]() | Protein automated matches [190406] (19 species) not a true protein |
![]() | Species Jellyfish (Aequorea victoria) [TaxId:6100] [188134] (58 PDB entries) |
![]() | Domain d4as8a1: 4as8 A:2-230 [194425] Other proteins in same PDB: d4as8a2 automated match to d3st2a_ complexed with edo, mg |
PDB Entry: 4as8 (more details), 1.02 Å
SCOPe Domain Sequences for d4as8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4as8a1 d.22.1.1 (A:2-230) automated matches {Jellyfish (Aequorea victoria) [TaxId: 6100]} skgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlv ttltwgvqcfarypdhmkqhdffksampegyvqertiffkddgnyktraevkfegdtlvn rielkgidfkedgnilghkleynaisdnvyitadkqkngikanfkirhniedgsvqladh yqqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagit
Timeline for d4as8a1: