SCOPe 2.08: Domain d4dgia_: 4dgi A:

Lineage for d4dgia_ (4dgi A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.6: Prion-like [54097] (1 superfamily)
   beta-alpha-beta-alpha(2); antiparallel beta-ribbon

4. Superfamily d.6.1: Prion-like [54098] (1 family)

5. Family d.6.1.1: Prion-like [54099] (3 proteins)

6. Protein automated matches [191016] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188783] (10 PDB entries)

8. Domain d4dgia_: 4dgi A: [194422]
   Other proteins in same PDB: d4dgih1, d4dgih2, d4dgil1, d4dgil2
   automated match to d1h0la_
   complexed with na

Details for d4dgia_

PDB Entry: 4dgi, 2.4 Å

PDB Description: Structure of POM1 FAB fragment complexed with human PrPc Fragment 120-230

PDB Compounds: (A:) major prion protein

SCOPe Domain Sequences for d4dgia_:

Sequence; same for both SEQRES and ATOM records:

>d4dgia_ d.6.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ggymlgsamsrpiihfgsdyedryyrenmhrypnqvyyrpmdeysnqnnfvhdcvnitik
qhtvttttkgenftetdvkmmervveqmcitqyeres

Timeline for d4dgia_:

• d4dgia_ first appeared in SCOPe 2.02
  
• d4dgia_ appears in SCOPe 2.07