Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.13: DsbA-like [100953] (4 proteins) contains an all-alpha subdomain insertion |
Protein automated matches [190208] (8 species) not a true protein |
Species Vibrio cholerae [TaxId:243277] [194420] (1 PDB entry) |
Domain d4dvca1: 4dvc A:0-181 [194421] Other proteins in same PDB: d4dvca2 automated match to d1beda_ complexed with dms, so4 |
PDB Entry: 4dvc (more details), 1.2 Å
SCOPe Domain Sequences for d4dvca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dvca1 c.47.1.13 (A:0-181) automated matches {Vibrio cholerae [TaxId: 243277]} aaqfkegehyqvlktpassspvvseffsfycphcntfepiiaqlkqqlpegakfqknhvs fmggnmgqamskayatmialevedkmvpvmfnrihtlrkppkdeqelrqifldegidaak fdaayngfavdsmvhrfdkqfqdsgltgvpavvvnnrylvqgqsaksldeyfdlvnyllt lk
Timeline for d4dvca1: