Lineage for d4dvca1 (4dvc A:0-181)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2131616Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2131617Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2133602Family c.47.1.13: DsbA-like [100953] (4 proteins)
    contains an all-alpha subdomain insertion
  6. 2133663Protein automated matches [190208] (8 species)
    not a true protein
  7. 2133701Species Vibrio cholerae [TaxId:243277] [194420] (1 PDB entry)
  8. 2133702Domain d4dvca1: 4dvc A:0-181 [194421]
    Other proteins in same PDB: d4dvca2
    automated match to d1beda_
    complexed with dms, so4

Details for d4dvca1

PDB Entry: 4dvc (more details), 1.2 Å

PDB Description: Structural and functional studies of TcpG, the Vibrio cholerae DsbA disulfide-forming protein required for pilus and cholera toxin production
PDB Compounds: (A:) Thiol:disulfide interchange protein dsbA

SCOPe Domain Sequences for d4dvca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dvca1 c.47.1.13 (A:0-181) automated matches {Vibrio cholerae [TaxId: 243277]}
aaqfkegehyqvlktpassspvvseffsfycphcntfepiiaqlkqqlpegakfqknhvs
fmggnmgqamskayatmialevedkmvpvmfnrihtlrkppkdeqelrqifldegidaak
fdaayngfavdsmvhrfdkqfqdsgltgvpavvvnnrylvqgqsaksldeyfdlvnyllt
lk

SCOPe Domain Coordinates for d4dvca1:

Click to download the PDB-style file with coordinates for d4dvca1.
(The format of our PDB-style files is described here.)

Timeline for d4dvca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4dvca2