SCOPe 2.05: Domain d2ojkb_: 2ojk B:

Lineage for d2ojkb_ (2ojk B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.0: automated matches [191400] (1 protein)
   not a true family

6. Protein automated matches [190526] (20 species)
   not a true protein

7. Species Zoanthus sp. [TaxId:105402] [193832] (8 PDB entries)

8. Domain d2ojkb_: 2ojk B: [194419]
   automated match to d1xssa_

Details for d2ojkb_

PDB Entry: 2ojk, 2.2 Å

PDB Description: crystal structure of green fluorescent protein from zoanthus sp at 2.2 a resolution

PDB Compounds: (B:) GFP-like fluorescent chromoprotein FP506

SCOPe Domain Sequences for d2ojkb_:

Sequence; same for both SEQRES and ATOM records:

>d2ojkb_ d.22.1.0 (B:) automated matches {Zoanthus sp. [TaxId: 105402]}
skhgltkemtmkyrmegcvdghkfvitgegigypfkgkqainlcvveggplpfaedilsa
afnygnrvfteypqdivdyfknscpagytwdrsflfedgavcicnaditvsveencmyhe
skfygvnfpadgpvmkkmtdnwepscekiipvpkqgilkgdvsmylllkdggrlrcqfdt
vykaksvprkmpdwhfiqhkltredrsdaknqkwhltehaiasgsalp

Timeline for d2ojkb_:

• d2ojkb_ first appeared in SCOPe 2.02
  
• d2ojkb_ appears in SCOPe 2.04
  
• d2ojkb_ appears in SCOPe 2.06
  
• d2ojkb_ appears in the current release, SCOPe 2.08