Lineage for d1ezfb_ (1ezf B:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 6574Fold a.128: Terpenoid synthases [48575] (1 superfamily)
  4. 6575Superfamily a.128.1: Terpenoid synthases [48576] (4 families) (S)
  5. 6584Family a.128.1.2: Squalene synthase [48580] (1 protein)
  6. 6585Protein Squalene synthase [48581] (1 species)
  7. 6586Species Human (Homo sapiens) [TaxId:9606] [48582] (1 PDB entry)
  8. 6588Domain d1ezfb_: 1ezf B: [19441]

Details for d1ezfb_

PDB Entry: 1ezf (more details), 2.15 Å

PDB Description: crystal structure of human squalene synthase

SCOP Domain Sequences for d1ezfb_:

Sequence, based on SEQRES records: (download)

>d1ezfb_ a.128.1.2 (B:) Squalene synthase {Human (Homo sapiens)}
nslsnslktcykylnqtsrsfaaviqaldgemrnavcifylvlraldtleddmtisvekk
vpllhnfhsflyqpdwrfmeskekdrqvledfptislefrnlaekyqtviadicrrmgig
maefldkhvtseqewdkychyvaglvgiglsrlfsasefedplvgedteransmglflqk
tniirdyledqqggrefwpqevwsryvkklgdfakpenidlavqclnelitnalhhipdv
itylsrlrnqsvfnfcaipqvmaiatlaacynnqqvfkgavkirkgqavtlmmdatnmpa
vkaiiyqymeeiyhripdsdpsssktrqiistirtqn

Sequence, based on observed residues (ATOM records): (download)

>d1ezfb_ a.128.1.2 (B:) Squalene synthase {Human (Homo sapiens)}
nslsnslktcykylnqtsrsfaaviqaldgemrnavcifylvlraldtleddmtisvekk
vpllhnfhsflyqpdwrfmeskekdrqvledfptislefrnlaekyqtviadicrrmgig
maefldkhvtseqewdkychyvaglvgiglsrlfsasefedplvgedteransmglflqk
tniirdyledqqggrefwpqevwsryvkklgdfakpenidlavqclnelitnalhhipdv
itylsrlrnqsvfnfcaipqvmaiatlaacynnqqvfkgavatnmpavkaiiyqymeeiy
hripdsdpsssktrqiistirtqn

SCOP Domain Coordinates for d1ezfb_:

Click to download the PDB-style file with coordinates for d1ezfb_.
(The format of our PDB-style files is described here.)

Timeline for d1ezfb_: