Lineage for d4h55a_ (4h55 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2778276Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 2778280Protein Concanavalin A [49901] (4 species)
    natural circle permutation: the "old" N- and C-termini are linked with a peptide bond, whereas the "new" ones correspond to a cleaved loop
  7. 2778281Species Brazilian jackbean (Canavalia brasiliensis) [TaxId:61861] [49903] (7 PDB entries)
  8. 2778285Domain d4h55a_: 4h55 A: [194405]
    automated match to d3ju9a_
    complexed with bdr, ca, dbb, mn

Details for d4h55a_

PDB Entry: 4h55 (more details), 2.15 Å

PDB Description: crystal structure of canavalia brasiliensis seed lectin (conbr) in complex with beta-d-ribofuranose
PDB Compounds: (A:) Concanavalin-Br

SCOPe Domain Sequences for d4h55a_:

Sequence, based on SEQRES records: (download)

>d4h55a_ b.29.1.1 (A:) Concanavalin A {Brazilian jackbean (Canavalia brasiliensis) [TaxId: 61861]}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvgkr
lsavvsypngdsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
hetnalhfmfnqfskdqkdlilqgdattgtegnlrltrvssngspqgssvgralfyapvh
iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan

Sequence, based on observed residues (ATOM records): (download)

>d4h55a_ b.29.1.1 (A:) Concanavalin A {Brazilian jackbean (Canavalia brasiliensis) [TaxId: 61861]}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvgkr
lsavvsypngdsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksntn
alhfmfnqfskdqkdlilqgdattgtegnlrltrvssngspqgssvgralfyapvhiwes
savvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan

SCOPe Domain Coordinates for d4h55a_:

Click to download the PDB-style file with coordinates for d4h55a_.
(The format of our PDB-style files is described here.)

Timeline for d4h55a_: