SCOPe 2.06: Domain d4haja_: 4haj A:

Lineage for d4haja_ (4haj A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
   variable number of helices and little beta structure; not a true fold

4. Superfamily a.138.1: Multiheme cytochromes [48695] (4 families)
   duplication: contains multiple CxxCH motifs

5. Family a.138.1.1: Cytochrome c3-like [48696] (5 proteins)

6. Protein automated matches [190934] (3 species)
   not a true protein

7. Species Geobacter sulfurreducens [TaxId:35554] [189147] (16 PDB entries)

8. Domain d4haja_: 4haj A: [194402]
   automated match to d1os6a_
   complexed with dxc, hem, so4; mutant

Details for d4haja_

PDB Entry: 4haj, 1.9 Å

PDB Description: crystal structure of ppca k9e mutant

PDB Compounds: (A:) PpcA

SCOPe Domain Sequences for d4haja_:

Sequence; same for both SEQRES and ATOM records:

>d4haja_ a.138.1.1 (A:) automated matches {Geobacter sulfurreducens [TaxId: 35554]}
addivlkaengdvkfphkahqkavpdckkchekgpgkiegfgkemahgkgckgcheemkk
gptkcgechkk

Timeline for d4haja_:

• d4haja_ first appeared in SCOPe 2.02
  
• d4haja_ appears in SCOPe 2.05
  
• d4haja_ appears in SCOPe 2.07
  
• d4haja_ appears in the current release, SCOPe 2.08