| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.138: Multiheme cytochromes [48694] (1 superfamily) variable number of helices and little beta structure; not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) ![]() duplication: contains multiple CxxCH motifs |
| Family a.138.1.1: Cytochrome c3-like [48696] (5 proteins) |
| Protein Cytochrome c7 (cytochrome c551.5, PpcA) [48703] (3 species) contains three heme groups; deletion of one of Cyt c3 heme-binding sites |
| Species Geobacter sulfurreducens, PpcA [TaxId:35554] [101502] (9 PDB entries) |
| Domain d4haja_: 4haj A: [194402] automated match to d1os6a_ complexed with dxc, hec, so4; mutant |
PDB Entry: 4haj (more details), 1.9 Å
SCOPe Domain Sequences for d4haja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4haja_ a.138.1.1 (A:) Cytochrome c7 (cytochrome c551.5, PpcA) {Geobacter sulfurreducens, PpcA [TaxId: 35554]}
addivlkaengdvkfphkahqkavpdckkchekgpgkiegfgkemahgkgckgcheemkk
gptkcgechkk
Timeline for d4haja_: