Lineage for d4hb6a_ (4hb6 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2734165Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 2734166Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 2734167Family a.138.1.1: Cytochrome c3-like [48696] (5 proteins)
  6. 2734224Protein Cytochrome c7 (cytochrome c551.5, PpcA) [48703] (3 species)
    contains three heme groups; deletion of one of Cyt c3 heme-binding sites
  7. 2734236Species Geobacter sulfurreducens, PpcA [TaxId:35554] [101502] (9 PDB entries)
  8. 2734239Domain d4hb6a_: 4hb6 A: [194399]
    automated match to d1os6a_
    complexed with dxc, hec, so4; mutant

Details for d4hb6a_

PDB Entry: 4hb6 (more details), 1.9 Å

PDB Description: crystal structure of ppca k22e mutant
PDB Compounds: (A:) PpcA

SCOPe Domain Sequences for d4hb6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hb6a_ a.138.1.1 (A:) Cytochrome c7 (cytochrome c551.5, PpcA) {Geobacter sulfurreducens, PpcA [TaxId: 35554]}
addivlkakngdvkfphkahqeavpdckkchekgpgkiegfgkemahgkgckgcheemkk
gptkcgechkk

SCOPe Domain Coordinates for d4hb6a_:

Click to download the PDB-style file with coordinates for d4hb6a_.
(The format of our PDB-style files is described here.)

Timeline for d4hb6a_: