SCOPe 2.01: Domain d1ubxa_: 1ubx A:

Lineage for d1ubxa_ (1ubx A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.128: Terpenoid synthases [48575] (1 superfamily)
   multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers

4. Superfamily a.128.1: Terpenoid synthases [48576] (5 families)
   duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J

5. Family a.128.1.1: Isoprenyl diphosphate synthases [48577] (4 proteins)

6. Protein Farnesyl diphosphate synthase (geranyltranstransferase) [48578] (3 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [48579] (5 PDB entries)

8. Domain d1ubxa_: 1ubx A: [19439]
   complexed with fpp, mg

Details for d1ubxa_

PDB Entry: 1ubx, 2.5 Å

PDB Description: structure of farnesyl pyrophosphate synthetase

PDB Compounds: (A:) Farnesyl Diphosphate Synthase

SCOPe Domain Sequences for d1ubxa_:

Sequence; same for both SEQRES and ATOM records:

>d1ubxa_ a.128.1.1 (A:) Farnesyl diphosphate synthase (geranyltranstransferase) {Chicken (Gallus gallus) [TaxId: 9031]}
spvvverereefvgffpqivrdltedgighpevgdavarlkevlqynapggkcnrgltvv
aayrelsgpgqkdaeslrcalavgwcielfqaaslvaddimdqsltrrgqlcwykkegvg
ldaindsfllessvyrvlkkycrqrpyyvhllelflqtayqtelgqmldlitapvskvdl
shfseerykaivkyktafysfylpvaaamymvgidskeehenakaillemgeyfqiqddy
ldcfgdpaltgkvgtdiqdnkcswlvvqclqrvtpeqrqllednygrkepekvakvkely
eavgmraafqqyeessyrrlqeliekhsnrlpkeiflglaqkiykrqk

Timeline for d1ubxa_:

• d1ubxa_ first appeared (with stable ids) in SCOP 1.55, called d1ubx__
  
• d1ubxa_ appears in SCOP 1.75
  
• d1ubxa_ appears in SCOPe 2.02
  
• d1ubxa_ appears in the current release, SCOPe 2.08