Lineage for d1ubx__ (1ubx -)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 6574Fold a.128: Terpenoid synthases [48575] (1 superfamily)
  4. 6575Superfamily a.128.1: Terpenoid synthases [48576] (4 families) (S)
  5. 6576Family a.128.1.1: Isoprenyl diphosphate synthases [48577] (1 protein)
  6. 6577Protein Farnesyl diphosphate synthase [48578] (1 species)
  7. 6578Species Chicken (Gallus gallus) [TaxId:9031] [48579] (5 PDB entries)
  8. 6583Domain d1ubx__: 1ubx - [19439]

Details for d1ubx__

PDB Entry: 1ubx (more details), 2.5 Å

PDB Description: structure of farnesyl pyrophosphate synthetase

SCOP Domain Sequences for d1ubx__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ubx__ a.128.1.1 (-) Farnesyl diphosphate synthase {Chicken (Gallus gallus)}
spvvverereefvgffpqivrdltedgighpevgdavarlkevlqynapggkcnrgltvv
aayrelsgpgqkdaeslrcalavgwcielfqaaslvaddimdqsltrrgqlcwykkegvg
ldaindsfllessvyrvlkkycrqrpyyvhllelflqtayqtelgqmldlitapvskvdl
shfseerykaivkyktafysfylpvaaamymvgidskeehenakaillemgeyfqiqddy
ldcfgdpaltgkvgtdiqdnkcswlvvqclqrvtpeqrqllednygrkepekvakvkely
eavgmraafqqyeessyrrlqeliekhsnrlpkeiflglaqkiykrqk

SCOP Domain Coordinates for d1ubx__:

Click to download the PDB-style file with coordinates for d1ubx__.
(The format of our PDB-style files is described here.)

Timeline for d1ubx__: