Lineage for d1ubxa_ (1ubx A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. Family a.128.1.1: Isoprenyl diphosphate synthases [48577] (4 proteins)
  6. Protein Farnesyl diphosphate synthase (geranyltranstransferase) [48578] (3 species)
  7. Species Chicken (Gallus gallus) [TaxId:9031] [48579] (5 PDB entries)
  8. Domain d1ubxa_: 1ubx A: [19439]
    complexed with fpp, mg

Details for d1ubxa_

PDB Entry: 1ubx (more details), 2.5 Å

PDB Description: structure of farnesyl pyrophosphate synthetase
PDB Compounds: (A:) Farnesyl Diphosphate Synthase

SCOPe Domain Sequences for d1ubxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ubxa_ a.128.1.1 (A:) Farnesyl diphosphate synthase (geranyltranstransferase) {Chicken (Gallus gallus) [TaxId: 9031]}
spvvverereefvgffpqivrdltedgighpevgdavarlkevlqynapggkcnrgltvv
aayrelsgpgqkdaeslrcalavgwcielfqaaslvaddimdqsltrrgqlcwykkegvg
ldaindsfllessvyrvlkkycrqrpyyvhllelflqtayqtelgqmldlitapvskvdl
shfseerykaivkyktafysfylpvaaamymvgidskeehenakaillemgeyfqiqddy
ldcfgdpaltgkvgtdiqdnkcswlvvqclqrvtpeqrqllednygrkepekvakvkely
eavgmraafqqyeessyrrlqeliekhsnrlpkeiflglaqkiykrqk

SCOPe Domain Coordinates for d1ubxa_ are not available.

Timeline for d1ubxa_: