Lineage for d4h4aa1 (4h4a A:89-253)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2216700Fold d.136: Phospholipase D/nuclease [56023] (1 superfamily)
    beta-alpha-beta-alpha-beta-alpha-beta(4)-alpha; mixed sheet: order 1765234
  4. 2216701Superfamily d.136.1: Phospholipase D/nuclease [56024] (6 families) (S)
  5. 2216838Family d.136.1.0: automated matches [194358] (1 protein)
    not a true family
  6. 2216839Protein automated matches [194381] (1 species)
    not a true protein
  7. 2216840Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [194383] (2 PDB entries)
  8. 2216841Domain d4h4aa1: 4h4a A:89-253 [194386]
    Other proteins in same PDB: d4h4aa2
    automated match to d1byra_

Details for d4h4aa1

PDB Entry: 4h4a (more details), 2.2 Å

PDB Description: crystal structure of the c-terminal domain of drosophila melanogaster zucchini
PDB Compounds: (A:) Mitochondrial cardiolipin hydrolase

SCOPe Domain Sequences for d4h4aa1:

Sequence, based on SEQRES records: (download)

>d4h4aa1 d.136.1.0 (A:89-253) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
slrnvakiveqidravysidlaiytftslfladsikralqrgviiriisdgemvyskgsq
ismlaqlgvpvrvpittnlmhnkfciidgferveeirllrklkfmrpcysivisgsvnwt
alglggnwenciitaddkltatfqaefqrmwrafaktegsqiqlk

Sequence, based on observed residues (ATOM records): (download)

>d4h4aa1 d.136.1.0 (A:89-253) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
slrnvakiveqidravysidlaiytftslfladsikralqrgviiriisdgemvyskgsq
ismlaqlgvpvrvpitlmhnkfciidgferveeirllrkrpcysivisgsvnwtgnwenc
iitaddkltatfqaefqrmwraqiqlk

SCOPe Domain Coordinates for d4h4aa1:

Click to download the PDB-style file with coordinates for d4h4aa1.
(The format of our PDB-style files is described here.)

Timeline for d4h4aa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4h4aa2