Lineage for d1ubwa_ (1ubw A:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1098464Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 1098465Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 1098466Family a.128.1.1: Isoprenyl diphosphate synthases [48577] (4 proteins)
  6. 1098467Protein Farnesyl diphosphate synthase (geranyltranstransferase) [48578] (3 species)
  7. 1098468Species Chicken (Gallus gallus) [TaxId:9031] [48579] (5 PDB entries)
  8. 1098472Domain d1ubwa_: 1ubw A: [19438]
    complexed with gpp, mg

Details for d1ubwa_

PDB Entry: 1ubw (more details), 2.5 Å

PDB Description: structure of farnesyl pyrophosphate synthetase
PDB Compounds: (A:) Farnesyl Diphosphate Synthase

SCOPe Domain Sequences for d1ubwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ubwa_ a.128.1.1 (A:) Farnesyl diphosphate synthase (geranyltranstransferase) {Chicken (Gallus gallus) [TaxId: 9031]}
spvvverereefvgffpqivrdltedgighpevgdavarlkevlqynapggkcnrgltvv
aayrelsgpgqkdaeslrcalavgwcielfqaaslvaddimdqsltrrgqlcwykkegvg
ldaindsfllessvyrvlkkycrqrpyyvhllelflqtayqtelgqmldlitapvskvdl
shfseerykaivkyktafysfylpvaaamymvgidskeehenakaillemgeyfqiqddy
ldcfgdpaltgavgtdiqdnkcswlvvqclqrvtpeqrqllednygrkepekvakvkely
eavgmraafqqyeessyrrlqeliekhsnrlpkeiflglaqkiykrqk

SCOPe Domain Coordinates for d1ubwa_:

Click to download the PDB-style file with coordinates for d1ubwa_.
(The format of our PDB-style files is described here.)

Timeline for d1ubwa_: