| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily) 4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication |
Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) ![]() different families of this superfamily are groupped in a single Pfam family, Pfam PF00149 |
| Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins) |
| Protein automated matches [190344] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187171] (5 PDB entries) |
| Domain d3v4ye_: 3v4y E: [194379] automated match to d1fjma_ complexed with 15p, gol, mn |
PDB Entry: 3v4y (more details), 2.1 Å
SCOPe Domain Sequences for d3v4ye_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3v4ye_ d.159.1.3 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lnldsiigrllevqgsrpgknvqlteneirglclksreiflsqpilleleaplkicgdih
gqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykikypenffllrgnhe
casinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdlqsmeqi
rrimrptdvpdqgllcdllwsdpdkdvqgwgendrgvsftfgaevvakflhkhdldlicr
ahqvvedgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilkpa
Timeline for d3v4ye_: