Lineage for d3v4ya_ (3v4y A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1938246Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 1938247Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 1938325Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins)
  6. 1938427Protein automated matches [190344] (3 species)
    not a true protein
  7. 1938430Species Human (Homo sapiens) [TaxId:9606] [187171] (8 PDB entries)
  8. 1938431Domain d3v4ya_: 3v4y A: [194378]
    automated match to d1fjma_
    complexed with 15p, gol, mn

Details for d3v4ya_

PDB Entry: 3v4y (more details), 2.1 Å

PDB Description: Crystal Structure of the first Nuclear PP1 holoenzyme
PDB Compounds: (A:) Serine/threonine-protein phosphatase PP1-alpha catalytic subunit

SCOPe Domain Sequences for d3v4ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3v4ya_ d.159.1.3 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lnldsiigrllevqgsrpgknvqlteneirglclksreiflsqpilleleaplkicgdih
gqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykikypenffllrgnhe
casinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdlqsmeqi
rrimrptdvpdqgllcdllwsdpdkdvqgwgendrgvsftfgaevvakflhkhdldlicr
ahqvvedgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilkpa

SCOPe Domain Coordinates for d3v4ya_:

Click to download the PDB-style file with coordinates for d3v4ya_.
(The format of our PDB-style files is described here.)

Timeline for d3v4ya_: