Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) |
Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (4 proteins) |
Protein automated matches [190053] (8 species) not a true protein |
Species Sulfolobus solfataricus [TaxId:2287] [190005] (6 PDB entries) |
Domain d4a2sa_: 4a2s A: [194376] automated match to d3nxfa_ complexed with 3nk |
PDB Entry: 4a2s (more details), 1.4 Å
SCOPe Domain Sequences for d4a2sa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4a2sa_ c.1.2.4 (A:) automated matches {Sulfolobus solfataricus [TaxId: 2287]} prylkgwledvvqlslrrpsvrasrqrpiislnerilefnkrnitaiiayysrkspsgld verdpieyakfmeryavglsikteekyfngsyetlrkiassvsipilmsdfivkesqidd aynlgadtvllivkiltereleslleyarsygmeplilindendldialrigarfigifs mnfetgeinkenqrklismipsnvvkvaklgiserneieelrklgvnaflissslmrnpe kikelie
Timeline for d4a2sa_: