Lineage for d4a2sa_ (4a2s A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1337250Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 1337745Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (4 proteins)
  6. 1337868Protein automated matches [190053] (8 species)
    not a true protein
  7. 1337895Species Sulfolobus solfataricus [TaxId:2287] [190005] (6 PDB entries)
  8. 1337897Domain d4a2sa_: 4a2s A: [194376]
    automated match to d3nxfa_
    complexed with 3nk

Details for d4a2sa_

PDB Entry: 4a2s (more details), 1.4 Å

PDB Description: structure of the engineered retro-aldolase ra95.5
PDB Compounds: (A:) indole-3-glycerol phosphate synthase

SCOPe Domain Sequences for d4a2sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a2sa_ c.1.2.4 (A:) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
prylkgwledvvqlslrrpsvrasrqrpiislnerilefnkrnitaiiayysrkspsgld
verdpieyakfmeryavglsikteekyfngsyetlrkiassvsipilmsdfivkesqidd
aynlgadtvllivkiltereleslleyarsygmeplilindendldialrigarfigifs
mnfetgeinkenqrklismipsnvvkvaklgiserneieelrklgvnaflissslmrnpe
kikelie

SCOPe Domain Coordinates for d4a2sa_:

Click to download the PDB-style file with coordinates for d4a2sa_.
(The format of our PDB-style files is described here.)

Timeline for d4a2sa_: