![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily) multihelical; consists of two all-alpha domains |
![]() | Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) ![]() |
![]() | Family a.93.1.1: CCP-like [48114] (5 proteins) |
![]() | Protein automated matches [190089] (9 species) not a true protein |
![]() | Species Radish (Raphanus sativus) [TaxId:3726] [194372] (1 PDB entry) |
![]() | Domain d4a5gb_: 4a5g B: [194374] automated match to d1pa2a_ complexed with 1pe, ca, hem, nag, pg0 |
PDB Entry: 4a5g (more details), 2.05 Å
SCOPe Domain Sequences for d4a5gb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4a5gb_ a.93.1.1 (B:) automated matches {Radish (Raphanus sativus) [TaxId: 3726]} ggslnatfyagtcpnasamvrtivqqafqsdsrigaslirlhfhdcfvlgcdasilldns gsiiseknagpnansargfnvvdniktalenacpgvvsctdvlalasqasvslsggpswt vdlgrrdtltanqaganssipsptqglsnitskfsavglntndlvalsgahtfgratcgv fsnrlfnfsgkgnpdptlnttllstlqelcpqkgrgsgstnldlstpdafdnnyftnlqs nngllqsdqelfsttgsatiaivtsfasnqtlffqafaqsminmgnispltgssgeirld ckktngs
Timeline for d4a5gb_: