Lineage for d4a5gb_ (4a5g B:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1496989Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 1496990Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 1496991Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. 1497288Protein automated matches [190089] (7 species)
    not a true protein
  7. 1497333Species Radish (Raphanus sativus) [TaxId:3726] [194372] (1 PDB entry)
  8. 1497335Domain d4a5gb_: 4a5g B: [194374]
    automated match to d1pa2a_
    complexed with 1pe, ca, hem, nag, pg0

Details for d4a5gb_

PDB Entry: 4a5g (more details), 2.05 Å

PDB Description: raphanus sativus anionic peroxidase.
PDB Compounds: (B:) anionic peroxidase

SCOPe Domain Sequences for d4a5gb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a5gb_ a.93.1.1 (B:) automated matches {Radish (Raphanus sativus) [TaxId: 3726]}
ggslnatfyagtcpnasamvrtivqqafqsdsrigaslirlhfhdcfvlgcdasilldns
gsiiseknagpnansargfnvvdniktalenacpgvvsctdvlalasqasvslsggpswt
vdlgrrdtltanqaganssipsptqglsnitskfsavglntndlvalsgahtfgratcgv
fsnrlfnfsgkgnpdptlnttllstlqelcpqkgrgsgstnldlstpdafdnnyftnlqs
nngllqsdqelfsttgsatiaivtsfasnqtlffqafaqsminmgnispltgssgeirld
ckktngs

SCOPe Domain Coordinates for d4a5gb_:

Click to download the PDB-style file with coordinates for d4a5gb_.
(The format of our PDB-style files is described here.)

Timeline for d4a5gb_: