Lineage for d4a5ga_ (4a5g A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719957Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2719958Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2719959Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. 2720315Protein automated matches [190089] (9 species)
    not a true protein
  7. 2720362Species Radish (Raphanus sativus) [TaxId:3726] [194372] (1 PDB entry)
  8. 2720363Domain d4a5ga_: 4a5g A: [194373]
    automated match to d1pa2a_
    complexed with 1pe, ca, hem, nag, pg0

Details for d4a5ga_

PDB Entry: 4a5g (more details), 2.05 Å

PDB Description: raphanus sativus anionic peroxidase.
PDB Compounds: (A:) anionic peroxidase

SCOPe Domain Sequences for d4a5ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a5ga_ a.93.1.1 (A:) automated matches {Radish (Raphanus sativus) [TaxId: 3726]}
gslnatfyagtcpnasamvrtivqqafqsdsrigaslirlhfhdcfvlgcdasilldnsg
siiseknagpnansargfnvvdniktalenacpgvvsctdvlalasqasvslsggpswtv
dlgrrdtltanqaganssipsptqglsnitskfsavglntndlvalsgahtfgratcgvf
snrlfnfsgkgnpdptlnttllstlqelcpqkgrgsgstnldlstpdafdnnyftnlqsn
ngllqsdqelfsttgsatiaivtsfasnqtlffqafaqsminmgnispltgssgeirldc
kktngsg

SCOPe Domain Coordinates for d4a5ga_:

Click to download the PDB-style file with coordinates for d4a5ga_.
(The format of our PDB-style files is described here.)

Timeline for d4a5ga_: