| Class b: All beta proteins [48724] (176 folds) |
| Fold b.22: TNF-like [49841] (1 superfamily) sandwich, 10 strands in 2 sheets; jelly-roll |
Superfamily b.22.1: TNF-like [49842] (2 families) ![]() |
| Family b.22.1.0: automated matches [191519] (1 protein) not a true family |
| Protein automated matches [190873] (3 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [188225] (20 PDB entries) |
| Domain d4f3ja_: 4f3j A: [194367] automated match to d1c3ha_ |
PDB Entry: 4f3j (more details), 1.34 Å
SCOPe Domain Sequences for d4f3ja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4f3ja_ b.22.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
arsafsakrsesrvpppsdaplpfdrvlvneqghydavtgkftcqvpgvyyfavhatvyr
aslqfdlvkngesiasffqffggwpkpaslsggamvrlepedqvwvqvgvgdyigiyasi
ktdstfsgflvysdwhsspvfah
Timeline for d4f3ja_: